KEGG   Helicobacter pylori Sat464: HPSAT_02550Help
Entry
HPSAT_02550       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3788
Motif
Other DBs
NCBI-ProteinID: ADO05255
Position
complement(507285..508022)
Genome map
AA seq 245 aa AA seqDB search
MLEALNAINQLNALHSKNAAHHFNATLPILLKVLEKQDKDLFLLQVGNRIIPTKSEQELK
INQPYFATMQRNQLGDIVLKNLVPAPKILDALDDLSVLEMKKIKEILSAKDNTPLKEYKE
LLSEKLIHAKNPQEFLNTANMLLSLQSQVLSFVIENERKKAFLQVKAKKQSVDFYALYPN
LGEIGGVIYLKEKEKQLFLKTSLQRTKEILKEAQNTLLGFSCVEIACEKTPMLFAFEERL
LDTIG
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctagaagccctaaacgccataaaccagcttaacgctcttcattccaaaaacgccgcg
caccattttaacgctaccttacccattcttttaaaggttttagaaaaacaagataaagat
cttttccttttgcaagtgggtaataggattatccccaccaaaagcgaacaggaattgaaa
atcaatcagccttattttgcgaccatgcaaagaaaccaactgggcgatattgtgcttaaa
aatttagtgcctgccccaaaaattttagacgcattggacgatttgagtgtgcttgaaatg
aaaaaaatcaaagaaatattgagcgctaaagacaatacccctttaaaagaatataaagaa
cttttgagcgaaaaattaatccatgctaaaaatccgcaagagtttttgaatacggccaac
atgcttttaagcttgcaatcgcaggtgttaagctttgtgattgaaaacgaacgcaaaaaa
gcttttttgcaagtgaaagccaaaaaacaaagcgttgatttttacgctctgtatcctaat
ttgggcgaaattggcggcgttatctatttaaaggaaaaagaaaaacagctttttttaaaa
acctccctccaaaggactaaagaaattttaaaagaggctcaaaacacccttttgggcttt
tcttgcgtggaaattgcgtgcgaaaaaacccccatgctttttgcctttgaagagcgttta
ttggacacgatagggtaa

DBGET integrated database retrieval system