KEGG   Helicobacter pylori Sat464: HPSAT_02650Help
Entry
HPSAT_02650       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
  KO
K07460  putative endonuclease
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0102 NERD Hjc PUB
Motif
Other DBs
NCBI-ProteinID: ADO05275
Position
complement(524975..525319)
Genome map
AA seq 114 aa AA seqDB search
MRFLNNKHRAKGLKAEEEACEFLKTLGFEIMERNFFSKFGEIDIIALKKGVLHFIEVKSG
ENFDPIYAITPSKLKKMIKTIRCYLSQKDPNSDFCIDALIVKNGKFELLENITF
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctttttgaataacaagcacagggcaaagggcttaaaggctgaagaagaggcctgc
gaatttttaaaaacgctgggttttgaaataatggagaggaactttttttcaaaatttggc
gaaattgatattatcgctttgaaaaaaggggttttgcatttcattgaagtcaaaagcggg
gaaaattttgatcccatttatgcgatcacgccgagtaaattaaaaaagatgattaaaacg
atccgctgttatttgtcccaaaaagatcccaatagcgatttttgcattgacgctcttatt
gtgaaaaatggtaaatttgagcttttagaaaatatcactttttag

DBGET integrated database retrieval system