KEGG   Helicobacter pylori Sat464: HPSAT_02660Help
Entry
HPSAT_02660       CDS       T01897                                 

Gene name
uvrC
Definition
(GenBank) excinuclease ABC subunit C
  KO
K03703  excinuclease ABC subunit C
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    HPSAT_02660 (uvrC)
DNA repair and recombination proteins [BR:hpt03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     HPSAT_02660 (uvrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrC_HhH_N GIY-YIG UVR HHH_2
Motif
Other DBs
NCBI-ProteinID: ADO05277
Position
complement(526598..528382)
Genome map
AA seq 594 aa AA seqDB search
MADLLSSLKNLSHSSGVYQYFDKNHQLLYIGKAKNLKKRIKSYFSIHNNEITPNYRASLR
IQMMVKQIAFLETILVENEQDALILENSLIKQLKPKYNILLRDDKTYPYIYMDFSTDFPI
PLITRKILKQPGVKYFGPFTSGAKDILDSLYELLPLVQKKNCIKDKKACMFYQIERCKAP
CENKITKEEYLKIAKECLEMIENKDKLIKELELKMERLSSNLRFEEALIYRDRIAKIQKI
APFTCMDLAKLYDLDIFAFYGKGNKAVLVKMFMRGGKIISSAFEKIHSLNGFDTDEAMKQ
AIINHYQSHLPLMPEQILLNACSNETLKELQEFISHQYSKKIALSIPKKGDKLALIEIAM
KNAQEIFSQEKTSNEDLILEEAQSLFKLECMPYRVEIFDTSHHANSQCVGGMVVYENHEF
QKNSYRRYHLKGSNEYTQMSELLTRRALDFAKEPPPNLWVIDGGRAQLNIALEILKSSGS
FVEVIAISKEKRDSKAYRSKGGAKDIIHTASDTFKLLPSDKRLQWVQKLRDESHRYAINF
HRSTKLKNMKQIALLKEKGIGEASVKKLLDYFGSFEAIEKASEQEKNAVLKKRI
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttattgtccagtttgaaaaacctttctcatagcagtggcgtgtatcaatat
tttgacaaaaaccaccaattactctatatcggtaaggcgaaaaatttaaaaaagcgcatc
aaaagctatttttctatccacaataatgaaatcacgcccaattatcgcgcaagcttacgc
atccaaatgatggtcaaacagatcgcttttttagaaaccattttagtggaaaacgagcaa
gacgctttgattttagaaaattctttaatcaagcagctcaagcctaaatacaacattctt
ttaagagacgataaaacttacccttatatttacatggatttttccactgatttccctatc
cctttaatcacacgaaaaattttaaaacagcctggcgttaaatattttgggccttttacg
agcggggctaaggatattttagacagcttgtatgaattgctcccgttagttcaaaagaaa
aattgcatcaaagataaaaaggcatgcatgttttatcaaatagagcgttgtaaagcccca
tgcgagaataaaatcaccaaagaagagtatttaaaaatcgctaaagaatgtttagaaatg
attgaaaataaagacaaactcatcaaagagcttgaattaaaaatggagcgcctttctagt
aacttgcgttttgaagaagccctcatttatagggataggattgcaaaaatccaaaaaatc
gcccctttcacttgcatggatttagccaaactctatgatttggatatttttgctttttat
ggcaagggtaataaggcggtgttagtgaaaatgtttatgcgtgggggtaaaatcatttct
tcagcgtttgaaaaaatccactctcttaatgggtttgacactgatgaagcgatgaaacaa
gccattatcaatcattaccaatcgcatttgcctttgatgccagaacagattttattgaac
gcttgctctaatgaaacgcttaaagaattgcaagaatttatctctcaccaatactctaaa
aaaatcgctcttagtattcctaaaaaaggcgataagctcgctttaatagaaatcgctatg
aaaaacgctcaagagatttttagccaggaaaaaacctctaatgaagatctgattttagaa
gaagcgcaatcgctctttaaattagagtgcatgccttatagagtggaaatctttgacaca
agccaccatgccaacagccaatgcgtggggggaatggtcgtgtatgaaaatcatgaattt
caaaaaaactcctatcggcgctaccatttaaaaggttctaatgaatacactcaaatgagc
gaattgctcaccagaagggctttagactttgccaaagagccgccgcctaatttgtgggtg
atcgatggagggagggcgcaattaaacatcgctttagaaattttaaaaagcagcgggagt
tttgtagaagtgatcgctatttctaaagaaaaaagggattctaaagcttatcgctctaaa
ggaggcgctaaagacattatccacaccgctagcgatacttttaaattgctccctagcgac
aagcgcttgcagtgggtgcaaaaattgcgcgatgaaagccaccggtatgcgataaacttc
catagatccactaaacttaaaaacatgaaacaaatcgctcttttaaaagaaaagggtata
ggagaagccagcgtgaaaaaattgttggattattttgggagttttgaagcgatagaaaaa
gcgagcgaacaagagaaaaacgctgttttaaaaaaacgaatctaa

DBGET integrated database retrieval system