KEGG   Helicobacter pylori Sat464: HPSAT_02765Help
Entry
HPSAT_02765       CDS       T01897                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  
GTP cyclohydrolase II [EC:3.5.4.25]
Organism
hpt  Helicobacter pylori Sat464
Pathway
Riboflavin metabolism
Folate biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Quorum sensing
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    HPSAT_02765 (ribA)
   00790 Folate biosynthesis
    HPSAT_02765 (ribA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    HPSAT_02765 (ribA)
Enzymes [BR:hpt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     HPSAT_02765 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
542271..542849
Genome map
AA seq 192 aa AA seqDB search
MKRLEVSNQAKLPTQFGEFCIQCFREKGSNGSKDHLVVFTPNFSQNPLVRLHSECLTGDA
LGSQKCDCGGALQMALERISKEGGLVIYLRQEGRGIGLFNKVNAYALQDKGYDTIQANEM
IGFKDDERDYSIAGEILEYYGIKKMRLLTNNPKKIAALEKYAEITRESLIVCANEHNQGY
LEVKKLKMGHLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgattagaagtttctaaccaagccaaattacccactcaatttggggagttttgt
atccagtgttttagagaaaagggttctaacggctctaaggatcatttagtggttttcacc
cctaatttttctcaaaaccccttagtgcgtttgcattcagaatgcttgaccggcgacgct
ctaggctctcaaaaatgcgattgcgggggggcgttgcaaatggcgttagaaaggatttct
aaagaaggggggctagtgatttatttgcgccaagaagggcgtgggatagggctatttaat
aaagtcaatgcctacgctttgcaagataagggctatgataccattcaagccaatgaaatg
atagggtttaaagacgatgaaagggattatagtattgcgggtgaaattttagaatattac
ggcattaaaaaaatgcgcttactcacaaacaaccctaaaaaaatcgccgctttagaaaaa
tacgctgagataacaagagagagcttgatcgtgtgcgctaatgaacataatcaagggtat
ttggaagtcaaaaagctcaaaatggggcatttattgtga

DBGET integrated database retrieval system