KEGG   Helicobacter pylori Sat464: HPSAT_02790Help
Entry
HPSAT_02790       CDS       T01897                                 

Definition
(GenBank) flagellar sheath adhesin
  KO
K15846  neuraminyllactose-binding hemagglutinin
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLBH PaaA_PaaC RAP
Motif
Other DBs
NCBI-ProteinID: ADO05303
Position
544729..545511
Genome map
AA seq 260 aa AA seqDB search
MKANNHFKDFAWKKCLLGVSVVALLVGCSPHIIETNEVTLKLNYHPASEKVQALDEKILL
LRPAFQYSDNIAKEYENKFKNQTTLKVEQILQNQGYKVINVDSSDKDDFSFAQKKEGYLA
VAMSGEIVLRPDPKRTIQKKSEPGLLFSTGLDKMEGVLISAGFIKVTILEPMSGESLDSF
TMDLSELDIQEKFLKTTHSSHSGGLVSTMVKGTDNSNDAIKSALNKIFTSIMQEIDKKLT
QKNLESYQKDAKELKNKRNR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaacaatcattttaaagattttgcatggaaaaaatgccttttaggcgtgagc
gtggtggctttattagtgggatgcagcccgcatattattgaaaccaatgaagtcactttg
aagttgaattaccatccagctagcgagaaagttcaagcgttagatgaaaagattctactt
ttaaggccggcttttcaatacagcgataatattgctaaagagtatgaaaacaaattcaag
aatcaaaccacgctcaaggttgaacagattttgcaaaatcagggctataaggttattaat
gtggatagcagcgataaagacgatttttcttttgcgcaaaaaaaagaagggtatttggcc
gtcgctatgagtggcgaaattgttttacgccccgatcctaaaagaaccatacagaaaaaa
tcagaacccgggttattattctccactggtttggataaaatggaaggggttttaatctcg
gctgggtttatcaaggttaccatactagaacctatgagtggggaatctttggattctttt
acgatggatttgagcgagttggacatccaagaaaaattcttaaaaaccacccattcaagc
catagcggggggttagttagcactatggttaagggaacggataattctaatgatgcgatc
aagagcgctttgaataagatttttacaagtatcatgcaagaaatagacaaaaaactcact
caaaagaatttagaatcttatcaaaaagacgccaaggaattgaaaaacaagagaaaccga
taa

DBGET integrated database retrieval system