KEGG   Helicobacter pylori Sat464: HPSAT_02795Help
Entry
HPSAT_02795       CDS       T01897                                 

Definition
(GenBank) outer membrane protein (omp18)
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADO05304
Position
545518..545712
Genome map
AA seq 64 aa AA seqDB search
MHTRERLNKLLKKGFLAFFLSVYLRADDLVTYTITKEEDLGYQRFLAKKCLRGYKQKLKP
YNNL
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgcacacaagagaacgcttgaacaaactgcttaaaaaggggtttttagcgttctttttg
agcgtgtatttaagggctgatgatctggttacttacacaatcaccaaagaagaagatcta
ggataccagcggtttttagcaaagaagtgtttaaggggttacaaacagaaactaaaaccc
tataataacctataa

DBGET integrated database retrieval system