KEGG   Helicobacter pylori Sat464: HPSAT_02800Help
Entry
HPSAT_02800       CDS       T01897                                 

Definition
(GenBank) Transposon IS607 OrfA, integrase-resolvase
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase MerR MerR_1 HTH_17 TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADO05305
Position
545775..546416
Genome map
AA seq 213 aa AA seqDB search
MLSIGQASKLLGVTIQTLRNWDKKDLLKPDELTKGGERRYKLESLRRINRNAVFNQDELK
TIAYARVSSHDQQEDLIRQVQVLELYCARCGFNYEVIQDLGSGMNYYKKGLTKLLNLILD
NQVKRLVLTHKDRLLRFGAELVFSICEAKEVEVVIINKGDENVRFEEELAKDVLEIITVF
SARLYGSRSKKNKKLLDEMQEVITNNVSYLNHA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgctatcaatcggtcaagcgagtaagcttttgggtgtaactatccaaaccttacgcaat
tgggataaaaaagatttgttaaaacctgatgaactcactaaaggcggtgaaaggcgttac
aagttagaaagtttaaggcgtatcaatagaaacgcagtctttaatcaagatgaattaaaa
acaatagcttatgctagagtaagctcgcatgaccaacaagaggatttaatcagacaagtt
caagttttagagctttattgcgctagatgcggctttaactatgaagtgatacaagattta
gggagtggcatgaactactataaaaaaggcttaaccaagctcttaaacttaatattagac
aatcaagtcaagcgccttgtattaacgcataaagacagattattacgctttggagccgaa
ttggtattcagtatttgtgaagctaaagaagtagaagtggttatcatcaataagggtgat
gagaatgtgaggtttgaagaagaattagccaaagatgttttagaaattataaccgtcttt
agcgctagattgtatggctctaggtctaagaaaaacaaaaaactcttagatgaaatgcaa
gaagtcataactaacaatgtcagctatctcaatcacgcataa

DBGET integrated database retrieval system