KEGG   Helicobacter pylori Sat464: HPSAT_02810Help
Entry
HPSAT_02810       CDS       T01897                                 

Definition
(GenBank) outer membrane protein (omp18)
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HP_OMP
Motif
Other DBs
NCBI-ProteinID: ADO05307
Position
547803..548399
Genome map
AA seq 198 aa AA seqDB search
MSWLQSREKFENHSKYRDIPFAEVSLIYGYKQFFPKKERYGFRFYISLDYAYGFFLKNKG
VLGDSLRESSQIPKSYREKLQRKETFINAIFYGVGADFLYKRAFGTLILGMNLVGETWFY
ETRIFKKWAKDPSSVYHPYMFQVMLNVGYRYRFSRYKNWVIELGARIPFLTNDYFKTPLY
TLHFRRNISVYLTSTYDF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggctacagagtagggaaaaatttgaaaaccattcaaaataccgagacattcct
tttgctgaagtcagtttgatttatggctataaacaattttttcctaaaaaagagcgctat
ggtttccgtttttatatttctttggattatgcctatggtttttttcttaaaaataaaggc
gtattgggcgatagtttgagggagagttcgcagatccctaaaagctatagggaaaaattg
caaagaaaagagacttttattaacgctattttttatggcgtgggagctgactttttatac
aaacgcgcttttggaacgctgattttagggatgaatctcgtgggcgaaacctggttttat
gaaacaaggatttttaaaaagtgggctaaagatccttcaagcgtttatcacccttacatg
tttcaagtgatgctgaatgtggggtatcgttaccgcttttcaaggtataagaattgggtg
atagaattgggcgcgcgtatcccctttttaaccaatgattattttaaaacccctttatac
acccttcatttcaggcgcaatatttctgtctatctcacttcaacttatgatttttag

DBGET integrated database retrieval system