KEGG   Helicobacter pylori Sat464: HPSAT_02840Help
Entry
HPSAT_02840       CDS       T01897                                 

Definition
(GenBank) anti-codon nuclease masking agent (prrB)
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
hpt  Helicobacter pylori Sat464
Brite
Enzymes [BR:hpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     HPSAT_02840
Prokaryotic defense system [BR:hpt02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   HPSAT_02840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S KASH_CCD
Motif
Other DBs
NCBI-ProteinID: ADO05313
Position
554650..555996
Genome map
AA seq 448 aa AA seqDB search
MHKIERLLQTLAPKGVEFKTLEEVFEIKNGYTPSKNNPEFWEKGTIPWFRMEDIRENGRI
LKDSIQHITPKALKGKKLFPKNSIIISTTATIGEHALLIVDSLANQRFTFLSKKANCDIA
LDMKFFFYQCFLLGEWCKKNTNVSGFASMDMTAFKKYKFPIPPLEIQQEIVKILDAFTEL
NTELNTELKARKKQYQYYQNMLLDFKDIHSNHKDAKISAKTYPKRLKTLLQTLAPKGVEF
RKLGDIGEFYSGLVGKSKKSFSQGNKFYVPYVNVFNNPQLDLNALESVQIGDKEKQNTIQ
LGDVLFTGSSENLEDCAMSCVVTQKIEKDIYLNSFCFGFRFFDENLFNPSFLKHFLRDYN
FRKNISKVANGVTRFNVSKQLLSKITIPIPPLEIQQEIVKILDQFLALTTDLLAGIPAEI
EARKKQYEYYREKLLTFKPLTPHKEVKK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatagagcgcttactccaaaccttagcgcctaagggggtggagtttaaaacg
cttgaagaggtttttgaaattaaaaatggttacaccccatcaaaaaacaatcctgaattt
tgggaaaaagggactatcccttggtttagaatggaagacattagagaaaatgggaggatt
ttaaaagactctatccaacacattaccccaaaggctttaaagggtaagaaattattccct
aaaaattctattattatttctacaacggcaactataggagagcatgcccttttaatcgtt
gattcgttagcgaatcaacgattcacttttttaagcaaaaaagcgaattgtgatattgct
ttagacatgaaattctttttttatcaatgttttcttttaggggaatggtgcaaaaaaaac
actaatgtttcaggttttgcttctatggatatgactgcttttaaaaaatataagttcccc
atcccacccctagaaatccaacaagagatcgttaagattttggacgctttcacagaatta
aacacagaattaaacacagaattaaaagcgcgaaaaaagcaataccagtattaccaaaac
atgcttttagactttaaggacatccattcaaaccataaagacgcaaaaattagcgcaaaa
acctaccccaaacgcttaaaaaccttactccaaaccttagcgcctaagggggtggagttt
aggaaattgggggatattggggaattttatagcggacttgttggaaaaagtaaaaaatct
ttctctcaagggaataaattttatgttccttatgtcaatgtttttaataatccacaatta
gatctaaatgctttagaaagcgttcaaataggggataaagaaaaacaaaatacgattcaa
ttaggcgatgtgctttttactggttcatctgaaaatttagaggattgtgcgatgtcttgc
gtagttactcaaaagattgaaaaagatatttatcttaatagtttttgttttggttttaga
ttttttgatgagaatttatttaatccatcgtttcttaaacattttttaagagactacaat
tttaggaaaaatatttcaaaagttgctaatggtgtaacacgcttcaatgtttcaaagcaa
ttactttcaaaaataacaatccccatcccacccctagaaatccaacaagagatcgttaag
attttggatcaattcttggccctaaccaccgatttattagccggtatcccggctgaaata
gaagccaggaaaaagcaatacgaatattacagagaaaaactactgacttttaaaccacta
accccccacaaagaagttaaaaaatga

DBGET integrated database retrieval system