KEGG   Helicobacter pylori Sat464: HPSAT_02910Help
Entry
HPSAT_02910       CDS       T01897                                 

Definition
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00970  Aminoacyl-tRNA biosynthesis
Module
hpt_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPSAT_02910
Enzymes [BR:hpt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     HPSAT_02910
Amino acid related enzymes [BR:hpt01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   HPSAT_02910
Transfer RNA biogenesis [BR:hpt03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HPSAT_02910
 Prokaryotic Type
    HPSAT_02910
Mitochondrial biogenesis [BR:hpt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HPSAT_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b S4 S4_2
Motif
Other DBs
NCBI-ProteinID: ADO05327
Structure
PDB: 

Jmol
Position
573689..574897
Genome map
AA seq 402 aa AA seqDB search
MEQKISIALKEIARGANEIIGLEYIEKLVRKYYETNERFIVKAGFDPTAPDLHLGHTVLI
QKLALLQQYGARVKFLIGDFTAMIGDPTGKNETRKPLNREQVLENAKTYEEQIYKILDQK
HTEVCFNSTWLDALGAKGIIELCAKFSVARMLERDDFTKRYKENRPISIVEFLYPLLQGY
DSVAMDADIELGGNDQKFNLLVGRFLQRAYGLNKEQSVITMPLLEGLDGVQKMSKSLGNY
VGITEEPNAMFGKIMSVSDDLMWRYYTLLSAKTLEEIEDLKHGILNQTLHPKAVKEDLAG
EIVARYYDNEQAIKAKEQFSKVFGANLLPEILLESDFDEGVGILDVLKQIGFCPSTSQAR
RDIQGGGVKINQEVVKNENYRFVKGNYVIQLGKKRFMKLNIN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaaatcagtatcgccttaaaagagatcgctagaggcgctaatgaaatcatt
ggattagaatatattgaaaagctggtgagaaaatattacgaaaccaatgaacgctttatc
gttaaagccgggtttgatcctaccgctccagatttgcatttagggcatacggtattgatc
caaaaactggctttattacagcaatatggggctagggttaagtttttgattggggatttt
accgctatgataggcgatcctacagggaaaaatgaaaccagaaagcctttaaaccgggag
caagtcttagaaaacgctaaaacttatgaagagcaaatctataaaattttagatcaaaaa
cacaccgaagtgtgttttaattccacttggcttgatgctttaggcgcaaaaggcattata
gaattgtgtgcgaagttttcagtcgctagaatgctagaaagggacgatttcaccaaacgc
tataaagaaaatcgccctattagcatcgtggaatttttataccctttgttgcaaggctat
gattcggtagcgatggatgcggatattgagcttgggggcaatgatcaaaagtttaatttg
ctggtggggcgctttttgcaacgggcttatggcttgaataaagagcagtctgtcattacc
atgcctttattagaggggcttgatggggtgcaaaaaatgagtaagagcttggggaattat
gtggggatcaccgaagagcctaatgcgatgtttgggaagatcatgagcgtgagcgatgat
ctcatgtggcgctattacacccttttgagcgctaagactttagaagaaattgaagactta
aaacatggcattttaaatcaaaccttgcaccctaaagccgttaaagaagatctcgctggt
gaaatcgtggctcgttattatgataatgaacaagccatcaaggctaaagagcaattttct
aaagtgtttggcgcaaatcttttgcctgaaattttattagagagcgattttgatgagggg
gtggggattttagatgttttaaaacagattggcttttgcccatccacttcacaagccagg
cgcgatattcaagggggaggggtaaagattaatcaagaagtggtaaaaaatgagaattat
cgttttgttaaaggaaattatgttatacagcttggtaagaaaagatttatgaaattaaat
attaactaa

DBGET integrated database retrieval system