KEGG   Helicobacter pylori Sat464: HPSAT_02925Help
Entry
HPSAT_02925       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
577347..578084
Genome map
AA seq 245 aa AA seqDB search
MNFYQKIYTHKVVFSSLFFLLFLFNVETLLLSHFSDDFSQLFFLFENHVYDFIVKLDYLG
LIGVSLIYLLVLILKPFTLTRQKCACVGILCLSFYAWNFPVKDSLMALYIFYFALLATLL
WRFLGASMKQSFLPSMNICIVWIFASSLQSFRFLSVSDCVDFSLFILALILLILVLIYHK
RLFGLYEYANMLILIVGLSVVVLYSSMLIQTKEYYGMRLGFYFLGLLGWLLEYVHNTLRR
LEHQI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttatcaaaaaatatacacgcataaagtcgttttttcttcattgtttttttta
ttgtttttgttcaatgtggaaactttgttgctttcgcatttcagcgacgatttttcgcaa
ttgttttttttgtttgaaaaccatgtttatgatttcattgtcaaattagattacttgggg
ttaataggcgtttctttaatttatctgcttgtgcttattctaaagcctttcaccctcacg
cgccaaaaatgcgcttgcgtagggatattatgcctttctttctacgcttggaattttccg
gttaaagattctttaatggcgctttatattttctattttgcactgttagcgactttattg
tggcgttttttaggggctagcatgaagcaatctttcttgccctctatgaatatttgcatc
gtgtggatttttgcttcttctttacagagttttagatttttaagcgtgtctgattgcgtg
gatttttccctttttatactcgctcttattttattgatactggttttaatctaccacaaa
cgcctttttgggttgtatgaatacgctaacatgctcattttgatcgtggggcttagcgtg
gtggtgctatactctagcatgctcattcaaactaaagaatactatggcatgcgattgggt
ttttattttttaggcttgttagggtggcttttagaatatgtgcataacactttaaggcgc
ttggagcatcaaatttaa

DBGET integrated database retrieval system