KEGG   Helicobacter pylori Sat464: HPSAT_02965Help
Entry
HPSAT_02965       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3479 Ribosomal_S20p z-alpha
Motif
Other DBs
NCBI-ProteinID: ADO05336
Position
582807..583766
Genome map
AA seq 319 aa AA seqDB search
MQDIQRQVSDARKTTNQYRKVDLLDVSGAVIGSAIGGVLAAYGAYTGVGLFASASTGTAI
AGLRGVAATNATLAWLGGGALSVGGLGVIGGMAVLGGLVAGPALAILGAVSAGEMEEKLE
KAKAYHSQVEVAVKKADVAIDNLLAVERVVKLFTKQITKCDALLFSLSQDAIATMKKHNY
NRFLYSQVEVAVKKADVAIDNLLAVERVVKLFTKQITKCDALLFSLSQDAIATMKKHNYN
RFLYNQEEKDQLCVTVPILMTLSAFLKVPIIDKDQKLQEKAQRALEIMKGQMDALESWQE
SGRYNVAMIQSRQKDLENL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacattcaacgccaggtttcagacgcgcgaaaaaccaccaatcaatatcgtaaa
gtggatttacttgatgtttccggtgcggttattgggagtgctataggaggagtgcttgcg
gcttatggcgcatacactggggtgggtcttttcgctagtgcgtctactggcacggcgatt
gctgggcttaggggtgttgcagcgacaaacgctacccttgcttggcttggcggtggggca
ctctctgtgggtggccttggtgtaattgggggtatggcagtgcttggagggcttgtggcc
gggcccgcactcgctattttgggagctgtgagtgctggtgaaatggaagagaagctagaa
aaagccaaggcttaccactctcaagttgaagtagctgtcaaaaaagcagatgtggcgatt
gataatcttttagccgttgagagagtggtaaagcttttcaccaagcaaatcaccaaatgc
gatgcgttgctcttttcgctctctcaagacgccatcgccacgatgaaaaaacacaactac
aatcgctttctttactctcaagttgaagtagctgtcaaaaaagcagatgtggcgattgat
aatcttttagccgttgagagagtggtaaagcttttcaccaagcaaatcaccaaatgcgat
gcgttgctcttttcgctctctcaagacgccatcgccacgatgaaaaaacacaactacaat
cgctttctttacaatcaagaagaaaaagatcagctctgcgttaccgttccaatcctcatg
actttgagcgcttttttgaaagtccccatcatagacaaagaccaaaagctccaagagaag
gcgcaaagggctttggagatcatgaaagggcagatggatgccctagaaagctggcaagaa
agcgggcgttataatgtggcaatgattcaatccaggcaaaaagatcttgaaaacctataa

DBGET integrated database retrieval system