KEGG   Helicobacter pylori Sat464: HPSAT_03060Help
Entry
HPSAT_03060       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: fn3 SQAPI Chordopox_A13L
Motif
Other DBs
NCBI-ProteinID: ADO05355
Position
complement(599416..600663)
Genome map
AA seq 415 aa AA seqDB search
MKKKYFTLLLQSSVVLAVFIGCSSTRNHTFSALSNQENTDTNLPVVHSVKTINDVSSVGF
EWPKIADTYDIDGFILYRLKKDSKLKKIATIKNPYATHYYDEGLETESSYTYQLATYKGD
KISKLSEPILVKTSFINPVESVFASLEYPKSVKVFWSPHPNPSVSKYIIQRQNKDGKFVS
VGAVRNRLFVEFFDKDLEDGKKYRYQVIAENFMGDKSRPSIIVEGKTKDLPKEIANVRVS
QNLTRHIELSWDKSPEEDVIAYRIYASNNRNDKYKFIAQTTNTSYVDKIEKDNLTRYYKV
VALDKTHLEGALPKDPAMGETADRPEAPIITKGTIQDSSALIQWENNPSAKIATYAVYRF
EANSKTPLRFGNITKNQFVDKDMKVGVSYRYQVVSVDKDGLESHPSKEVRLFLER
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaatacttcacgcttttattgcaaagtagtgtggtattagcggtttttata
gggtgttcttctaccaggaatcatactttttcagcccttagtaatcaagaaaatacagac
actaatcttccggtagtccattctgttaaaacgattaacgatgtgagttcagtgggtttt
gaatggcctaaaatcgctgatacttatgatattgatgggtttattttgtatcgtttgaaa
aaagactccaagcttaaaaaaatcgccacgattaaaaacccttatgcgacccactattat
gatgaggggctagaaacagagagttcctacacttaccagctcgctacttacaagggcgat
aaaatctctaaactttcagaacccattttagtgaaaacctcttttattaatcccgtagaa
agcgtgtttgcaagccttgaataccctaaaagcgtgaaagtcttttggagcccgcaccct
aaccctagcgtttctaaatacatcatccaaaggcagaataaagacggcaaatttgttagc
gtaggggctgttaggaaccgcttgtttgtagagttttttgataaagatttagaagatggg
aaaaaataccgctaccaagtcatcgccgaaaatttcatgggggataaatccaggcctagc
atcatagtagaagggaaaaccaaagatttacccaaagaaatcgctaatgttagagtgagc
caaaacctcacccgacacattgaattgagttgggacaaatcccctgaagaagatgtgata
gcttatcgcatttacgcttccaataaccgcaacgataaatacaaattcatcgctcaaacc
accaacacttcctatgtggataaaatagaaaaagacaacctcactcgttattataaagtc
gtcgcccttgataaaacgcatcttgaaggggcattacctaaagatcctgcaatgggtgag
accgctgataggcccgaagcccctatcatcactaaagggactattcaagactcttcagcc
ctcattcaatgggaaaataacccaagcgctaaaatagccacttatgcggtgtatcgtttt
gaagccaactctaaaacccctttgcgctttgggaatatcaccaaaaaccaattcgtggat
aaagacatgaaagtgggcgtgtcttatcgctaccaagtggtgagcgtggataaagatggt
ttagagtcgcacccaagcaaagaagtgcgtctgtttttagagcgctaa

DBGET integrated database retrieval system