KEGG   Helicobacter pylori Sat464: HPSAT_05305Help
Entry
HPSAT_05305       CDS       T01897                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00010  Glycolysis / Gluconeogenesis
hpt00020  Citrate cycle (TCA cycle)
hpt00620  Pyruvate metabolism
hpt00640  Propanoate metabolism
hpt00650  Butanoate metabolism
hpt00680  Methane metabolism
hpt01100  Metabolic pathways
hpt01120  Microbial metabolism in diverse environments
hpt01130  Biosynthesis of antibiotics
hpt01200  Carbon metabolism
Module
hpt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSAT_05305
   00020 Citrate cycle (TCA cycle)
    HPSAT_05305
   00620 Pyruvate metabolism
    HPSAT_05305
   00640 Propanoate metabolism
    HPSAT_05305
   00650 Butanoate metabolism
    HPSAT_05305
  Energy metabolism
   00680 Methane metabolism
    HPSAT_05305
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSAT_05305
Enzymes [BR:hpt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSAT_05305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ADO05779
Position
1076275..1076835
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIENIFADEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKGAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcgcgagcgggtcaaggcgctatcaccggcgctaaaggg
ttggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggagctgctatgatggcttataaccgcattgatgatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatccgggtttggttttcatt
gaaaacatcttcgctgatgaaaaagaagacacgacctatatcatcaccagctatcttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccctaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaatcggggcttttaaaggagcttttaagaaa
gttttgggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system