KEGG   Helicobacter pylori Sat464: HPSAT_05305Help
Entry
HPSAT_05305       CDS       T01897                                 

Definition
pyruvate flavodoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hpt  Helicobacter pylori Sat464
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPSAT_05305
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSAT_05305
   00020 Citrate cycle (TCA cycle)
    HPSAT_05305
   00620 Pyruvate metabolism
    HPSAT_05305
   00640 Propanoate metabolism
    HPSAT_05305
   00650 Butanoate metabolism
    HPSAT_05305
  Energy metabolism
   00680 Methane metabolism
    HPSAT_05305
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSAT_05305
Enzymes [BR:hpt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSAT_05305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1076275..1076835
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIENIFADEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKGAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcgcgagcgggtcaaggcgctatcaccggcgctaaaggg
ttggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggagctgctatgatggcttataaccgcattgatgatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatccgggtttggttttcatt
gaaaacatcttcgctgatgaaaaagaagacacgacctatatcatcaccagctatcttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccctaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaatcggggcttttaaaggagcttttaagaaa
gttttgggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system