KEGG   Helicobacter pylori Sat464: HPSAT_05895Help
Entry
HPSAT_05895       CDS       T01897                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpt  Helicobacter pylori Sat464
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPSAT_05895 (hemD)
Enzymes [BR:hpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HPSAT_05895 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201723..1202403
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLK
ILQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEILPLLEKKSVLYLRAKEIAS
SLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSVLIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEKGIQSYSAKKPSLEACLELALSLRVKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattttgctactatcccttagaattagatccaaccccttttaacgcccttattttc
acctctaaaaatgcggtgttttccttgctagaaactctaaaaaacagccccaaactcaag
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaactttacaagat
caccattttaaggtcgcctttataggggaaaaagcccatggcaaagagttcgttcaagaa
atccttcctttattggaaaaaaaaagcgttttgtatctcagggcaaaagagattgcctct
tctttagacaccattcttttagagcatggcattgatttcaaacaagccgttgtttatgaa
aacaagctcaaacatttaaccttaagcgaacaaaacgccctaaaacccaaagaaaagagc
gttcttatttttaccgctataagccatgcaaaagccttcttgcactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttgcaagagaaaggc
attcaaagctatagcgccaaaaagccctccttagaagcatgtttagaactggctttgagt
ttgagggttaaagaatgttaa

DBGET integrated database retrieval system