KEGG   Helicobacter pylori Sat464: HPSAT_06175Help
Entry
HPSAT_06175       CDS       T01897                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00260  Glycine, serine and threonine metabolism
hpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpt01100  Metabolic pathways
hpt01110  Biosynthesis of secondary metabolites
hpt01130  Biosynthesis of antibiotics
hpt01230  Biosynthesis of amino acids
Module
hpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSAT_06175 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSAT_06175 (trpA)
Enzymes [BR:hpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSAT_06175 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADO05942
Position
complement(1253388..1254176)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIVSGVSALELGFAFSDPVADG
ITIQASHLRALKHASMAKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASNKDLEQAAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKTFSPTPALLGFGISKKEHIKNAKGMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFIGEMIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaatggagttttgaaatcattaaaaccttaatt
gttagcggggtgagcgctttagaattggggtttgctttctccgatccggtagcggatggc
attaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagctcttaagggcgatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgctagccccaatgcgagtaataaagat
ttagaacaagccgctatgcattcgcagggttatatctacactctggctaggagtggggtt
acaggagcgagccgtattttggaaaatgacgcgagcgctattattaaaaccttaaaaacc
tttagtcctacccccgccttattgggctttggcatttctaaaaaagaacacataaaaaac
gctaaaggcatgggcgctgatggcgtgatttgcggctcagcgttagtcaagatcatagaa
gaaaatttgaacgatgaaaacgccatgctagaaaaaattaaagggtttataggagaaatg
atctcttaa

DBGET integrated database retrieval system