KEGG   Helicobacter pylori Sat464: HPSAT_06180Help
Entry
HPSAT_06180       CDS       T01897                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpt  Helicobacter pylori Sat464
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSAT_06180
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSAT_06180
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSAT_06180
Enzymes [BR:hpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSAT_06180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1254166..1255353)
Genome map
AA seq 395 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEEFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVEEVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESTRAIYESASDFEALEAFSLLCQKEGIIPALESSHALAYALKLS
QKCEEESIIVVNLSGRGDKDLSTVYNTLKGGLNEV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaggaattccaa
aaagaatatttccatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggtggggcgcacaagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgtttattaggcgctgaagtagaagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggaatatttagt
gcgtttttaaatgataaagaagttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattatagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagcactcgcgcg
atttatgaaagcgcaagcgattttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagcgtatgccttaaaactctct
caaaaatgcgaagaagaaagcatcattgtagtgaatttaagcggtcgtggggataaggat
ttaagcaccgtttataacactttaaaaggaggtttaaatgaggtataa

DBGET integrated database retrieval system