KEGG   Helicobacter pylori Sat464: HPSAT_06180Help
Entry
HPSAT_06180       CDS       T01897                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00260  Glycine, serine and threonine metabolism
hpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpt01100  Metabolic pathways
hpt01110  Biosynthesis of secondary metabolites
hpt01130  Biosynthesis of antibiotics
hpt01230  Biosynthesis of amino acids
Module
hpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSAT_06180
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSAT_06180
Enzymes [BR:hpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSAT_06180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADO05943
Position
complement(1254166..1255353)
Genome map
AA seq 395 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEEFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVEEVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESTRAIYESASDFEALEAFSLLCQKEGIIPALESSHALAYALKLS
QKCEEESIIVVNLSGRGDKDLSTVYNTLKGGLNEV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaggaattccaa
aaagaatatttccatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggtggggcgcacaagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgtttattaggcgctgaagtagaagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggaatatttagt
gcgtttttaaatgataaagaagttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattatagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagcactcgcgcg
atttatgaaagcgcaagcgattttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagcgtatgccttaaaactctct
caaaaatgcgaagaagaaagcatcattgtagtgaatttaagcggtcgtggggataaggat
ttaagcaccgtttataacactttaaaaggaggtttaaatgaggtataa

DBGET integrated database retrieval system