KEGG   Helicobacter pylori Cuz20: HPCU_00460Help
Entry
HPCU_00460        CDS       T01894                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hpu00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hpu00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(89633..91093)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNGALKTRQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIDKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTHEKTLVSATASYEKFP
RTTLLALNEQKKNDNDKTALETLKNSYNTPDSQRLDDLFERGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcattttgaaacattagaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcggttg
gggttagagattcctaagggtttattaacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttaatgcttgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttggtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacggcgctttaaaaacgcgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgcgttaggggcgttttatgccaaaaaaatgggtttgaatatt
gataaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaacttactcgccggctatggatatttta
aaaagctctaatgtggaaagagtgctttttgacctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaagttttatgcattaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgaccctcacaccgccaccgctttaaacgcc
agcttgaaaacccatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattcccc
agaaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccagatagccagcgccttgatgatttatttgaa
agaggaatcaagcaccaagaggttttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system