KEGG   Helicobacter pylori Cuz20: HPCU_00530Help
Entry
HPCU_00530        CDS       T01894                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106647..107285
Genome map
AA seq 212 aa AA seqDB search
MPSMNTHTRGIDSNLIHSLKSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKHFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcatgaacacacacacaagaggcattgacagcaatctgattcattcgctcaaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcgcgcattggcacgaatcaatttgtgattaataaaaggaacgctgtttttgatcaattg
aatgaaaacaccttattggttttgcatgataagattgattaccgctggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tatgcacgccctccttatagcttggcgtattccttgcgccacaaccgattgctccctagg
gattatttagggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaa
cattttgtcttcattaaggggtgtgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactaggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system