KEGG   Helicobacter pylori Cuz20: HPCU_00940Help
Entry
HPCU_00940        CDS       T01894                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hpu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
183834..184538
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLEELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGAQN
AYPRDCGAFTGEITSQHLEELKINTLLIGHSERRLLLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttagaagaattagaaaagactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggggcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcacagcatttagaagaa
ctcaaaatcaacacgcttttaatagggcatagcgagaggcgattgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgcattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
aacgagcaattagaaaatattgatcttaattatcctaatttagtggtggcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagatatttatctcacgcatggt
tttttaaagcaaattttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgcg
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgattgggagtgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system