KEGG   Helicobacter pylori Cuz20: HPCU_00940Help
Entry
HPCU_00940        CDS       T01894                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
hpu00010  Glycolysis / Gluconeogenesis
hpu00051  Fructose and mannose metabolism
hpu01100  Metabolic pathways
hpu01110  Biosynthesis of secondary metabolites
hpu01120  Microbial metabolism in diverse environments
hpu01130  Biosynthesis of antibiotics
hpu01200  Carbon metabolism
hpu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPCU_00940 (tpiA)
   00051 Fructose and mannose metabolism
    HPCU_00940 (tpiA)
   00562 Inositol phosphate metabolism
    HPCU_00940 (tpiA)
Enzymes [BR:hpu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPCU_00940 (tpiA)
Exosome [BR:hpu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPCU_00940 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPCU_00940 (tpiA)
  Exosomal proteins of melanoma cells
   HPCU_00940 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADO03372
Structure
PDB: 

Jmol
Position
183834..184538
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLEELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGAQN
AYPRDCGAFTGEITSQHLEELKINTLLIGHSERRLLLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttagaagaattagaaaagactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggggcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcacagcatttagaagaa
ctcaaaatcaacacgcttttaatagggcatagcgagaggcgattgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgcattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
aacgagcaattagaaaatattgatcttaattatcctaatttagtggtggcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagatatttatctcacgcatggt
tttttaaagcaaattttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgcg
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgattgggagtgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system