KEGG   Helicobacter pylori Cuz20: HPCU_01710Help
Entry
HPCU_01710        CDS       T01894                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
hpu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpu01100  Metabolic pathways
hpu01110  Biosynthesis of secondary metabolites
hpu01130  Biosynthesis of antibiotics
hpu01230  Biosynthesis of amino acids
Module
hpu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPCU_01710
Enzymes [BR:hpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPCU_01710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ADO03517
Position
335027..335584
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIISKTKDCVFVTPDEVLGKLLE
ENAHTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKPDYTHLKDLGVLGVLEKVPHSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagaattatt
tctaaaaccaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacgcccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttgttgcgccgccatgcgagctctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggcagaattc
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaagccagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
atagtttttttagattga

DBGET integrated database retrieval system