KEGG   Helicobacter pylori Cuz20: HPCU_03520Help
Entry
HPCU_03520        CDS       T01894                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hpu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hpu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707355..708623
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQVPLKGGVEISGAKNSALPILAATLLSQQEVKIKSLPQVVDIKAMALLLQNL
GASLEWLDPNTLQISAKSLHHTEATYDLVRKMRASILVLGPLLARFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEIKIEQGYIHAKAPKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEITQLCAFLQSGGVEIEGVGSSELKIRGVENDALNLKDIQIIPDRIEAG
TYLCVGAITNSQLKINRIIPNHLQAITDKLIEIGFSLNIQENSIEIYPAQKRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSVIEETLFENRFMHASELQRLGANISLKTNIATISGS
TELTGSDVMATDLRASSALILAALVAKGVSRVHRIYHLDRGYERLEDKINALGAKVARLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggattttttagagattgtaggacaagtccctttaaaagggggggtagaaatttcaggg
gcgaaaaactccgcactccccattttagccgccacgcttttaagccaacaggaagttaaa
atcaaatctttgccccaagtggtggatataaaggcgatggcgttattgttgcaaaattta
ggcgcaagcttagaatggcttgatcctaacacgcttcaaatcagcgccaaatccttgcac
cacaccgaagccacttacgatttggtgcgtaaaatgcgcgcttccattttggttttaggc
ccactattagcgcgttttaaagaatgtttggtgagtttgcccggtgggtgcgctatagga
gcaaggcctgtggatttgcacttaaaagcgatgcaacaattaggggctgaaatcaaaatt
gagcaaggctatatccatgcaaaagcccctaaaggcttgaaagggaatgatattttattt
gataagatcagcgttacaggcacagaaaacgccctcatggcagcaagcttagctaaaggg
atcacgcgcatcattaacgctgctaaagagccagaaatcactcaattgtgcgcgttttta
cagagtgggggggtagaaattgagggcgttggcagcagcgagttaaagattagaggggta
gaaaatgacgctttaaatttaaaagacattcaaatcatacccgataggattgaagcaggc
acttatttatgcgtgggggctatcactaacagccagcttaaaatcaatcgcatcatccct
aaccatcttcaagcaatcactgataagctcatagaaattggtttttcgctaaacattcaa
gaaaattctatagaaatttatccggcccaaaaacgccaagcctttgaaatcaccacgaaa
gaatacccaggctttcccacagacatgcaagcgcaattcatggcgttggccacgcagtgt
ttggggacgagcgtgattgaagagacgctttttgaaaaccgcttcatgcatgcaagcgaa
ttgcaacgcttgggggctaatatcagcctaaaaaccaatatcgctaccattagcggatcc
acagagcttaccggaagcgatgtgatggcgaccgatttaagggcttcttcggctctcatt
ttagccgctttagtggctaagggcgtgagtagggtgcataggatttaccacttggataga
ggttatgagagattagaggataaaatcaacgccttaggggcaaaagttgcgcgcttaaaa
gaaaaataa

DBGET integrated database retrieval system