KEGG   Helicobacter pylori Cuz20: HPCU_05525Help
Entry
HPCU_05525        CDS       T01894                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hpu  Helicobacter pylori Cuz20
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1132601..1133230
Genome map
AA seq 209 aa AA seqDB search
MKSIKNHLMCEEINKRFSLHPKVREAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLNNVHVKFADGNKGWDQYAPYDRILFSACTKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALHVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagtattaaaaaccatttgatgtgtgaagaaatcaataagcgtttcagtttgcac
cccaaagtgagagaggctatggaaagcattgaaagggaagtttttgtgccagcccctttt
aaacattttgcttacactttaaacgcgctttctatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggtgctttctcaaattttcaggcgcgtt
tttagcattgaaaggattgaaagcttgtatatagaagcgcgtttgcgccttaaaactctc
ggtctaaacaacgttcatgttaaattcgctgatgggaataagggctgggatcaatacgct
ccctatgataggattttattctctgcttgcactaaaaatatccctcaagcgctgattgat
cagcttgaagaaggcgggatattagtcgcgcccattcaagaaaataacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgcacgtccaaaaagtgttagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system