KEGG   Helicobacter pylori Cuz20: HPCU_05585Help
Entry
HPCU_05585        CDS       T01894                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
hpu00010  Glycolysis / Gluconeogenesis
hpu00052  Galactose metabolism
hpu00500  Starch and sucrose metabolism
hpu00520  Amino sugar and nucleotide sugar metabolism
hpu00521  Streptomycin biosynthesis
hpu01100  Metabolic pathways
hpu01110  Biosynthesis of secondary metabolites
hpu01120  Microbial metabolism in diverse environments
hpu01130  Biosynthesis of antibiotics
hpu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPCU_05585 (glk)
   00052 Galactose metabolism
    HPCU_05585 (glk)
   00500 Starch and sucrose metabolism
    HPCU_05585 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPCU_05585 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPCU_05585 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPCU_05585 (glk)
Enzymes [BR:hpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPCU_05585 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADO04265
Position
1144496..1145506
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRVRFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattttatctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttggatttaaaa
aaattgcttgtcatcaacgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctagctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagcttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaagccctatctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggatactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatcccg
cgattcattgattattttaaaacttcgccctttagagtgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccgggactt
gatggggcgggcattgcattagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system