KEGG   Helicobacter pylori Cuz20: HPCU_05630Help
Entry
HPCU_05630        CDS       T01894                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:hpu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hpu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hpu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hpu00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hpu00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:hpu00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153894..1154838
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPSGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGSCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgaaaaattccaaggc
tcgcacttgctttgtccgggttgcgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggcggtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtggaagcgatgtataaagcgctagtgaataagggccgctatcaaggt
caaaaaccaaaatttgtggcgtttgggggcgatggggccagttatgatattggtttgcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctagataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccatcaggatcggttagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggagtcccttatgtggcgcagctctcgcctaacaaatggaaagac
atgaacaaaaagattaaaaccgcactagacactgaagggtcttgcttcatcaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccctatttgaaatctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaagaaaacgaacacattattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system