KEGG   Helicobacter pylori Cuz20: HPCU_05630Help
Entry
HPCU_05630        CDS       T01894                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPCU_05630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPCU_05630
   00020 Citrate cycle (TCA cycle)
    HPCU_05630
   00620 Pyruvate metabolism
    HPCU_05630
   00640 Propanoate metabolism
    HPCU_05630
   00650 Butanoate metabolism
    HPCU_05630
  Energy metabolism
   00680 Methane metabolism
    HPCU_05630
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPCU_05630
Enzymes [BR:hpu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPCU_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153894..1154838
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPSGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGSCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgaaaaattccaaggc
tcgcacttgctttgtccgggttgcgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggcggtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtggaagcgatgtataaagcgctagtgaataagggccgctatcaaggt
caaaaaccaaaatttgtggcgtttgggggcgatggggccagttatgatattggtttgcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctagataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccatcaggatcggttagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggagtcccttatgtggcgcagctctcgcctaacaaatggaaagac
atgaacaaaaagattaaaaccgcactagacactgaagggtcttgcttcatcaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccctatttgaaatctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaagaaaacgaacacattattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system