KEGG   Helicobacter pylori Cuz20: HPCU_06265Help
Entry
HPCU_06265        CDS       T01894                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPCU_06265
Enzymes [BR:hpu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPCU_06265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282559..1283701
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDALKNALLKTGSEKCAQTHMHKKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSANQLERLIVKCHSQPFGLKNLAQELKSHLKSQKPNNPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPQSETIDPKIEQDR
LKEVLLEIKSQKLYQCAKFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVAKDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLGLHLMALQNGASILRV
HDIDEHIDLIKVFKSLEETN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaacccggatgcgctcaaaaacgcccttttaaaaaccggatca
gaaaaatgcgctcaaacccatatgcataaaaaaggcgttagctttgtttttgaaatccag
catctgcccttaagcgcaacgctcattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgctgatt
gtgagcgctaaccagttagaacgccttattgtcaagtgccactcccaaccctttgggctt
aaaaatttagcgcaagaattaaaaagccaccttaaatcccaaaagcctaacaacccacag
atcatggcaattttgaatctcacgccggatagtttttatgaaaaaagccggtttgatagc
aaaaaagcgcttgaagaaatctatcaattattagaaaagggtatcacgctcattgatata
ggcgcggcgagttcaaggccacagagtgaaaccattgatccaaaaatagagcaagatcgc
ttaaaagaagttttattagaaatcaaatcccaaaaactctaccaatgcgctaaattcagc
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttaatagtattgaaatgctagaagtcgccaaagattacaagccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
tacgcgcttcaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gccggcactttgggtttgcatttaatggcgttacaaaatggagcgagcattttaagagtg
catgacattgatgagcatatagacctcatcaaggtgtttaagagtttagaagaaacaaat
tga

DBGET integrated database retrieval system