KEGG   Helicobacter pylori Cuz20: HPCU_06515Help
Entry
HPCU_06515        CDS       T01894                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPCU_06515
   00030 Pentose phosphate pathway
    HPCU_06515
   00051 Fructose and mannose metabolism
    HPCU_06515
   00052 Galactose metabolism
    HPCU_06515
   00500 Starch and sucrose metabolism
    HPCU_06515
   00520 Amino sugar and nucleotide sugar metabolism
    HPCU_06515
  Nucleotide metabolism
   00230 Purine metabolism
    HPCU_06515
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPCU_06515
Enzymes [BR:hpu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPCU_06515
    5.4.2.8  phosphomannomutase
     HPCU_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1326905..1328284
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSTFSIGVELGKIMREYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPKKANALEAYQRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALSIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINAFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLED
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEVLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLGLLEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagat
gaaaagagcacctttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgatcgctttttgaagctttgagc
gccgggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagacaacatccaatgccccaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaagatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaagcattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatgtttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatgcttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaagac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaagtgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccactccgtatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagagtataaaagagcgttacttgggctattagaaaaactttaa

DBGET integrated database retrieval system