KEGG   Helicobacter pylori Cuz20: HPCU_06540Help
Entry
HPCU_06540        CDS       T01894                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPCU_06540 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPCU_06540 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPCU_06540 (trpA)
Enzymes [BR:hpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPCU_06540 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1329758..1330546)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQEKMAFIPFVTLGDPNYEWSFEIIKTLIVSGVSALELGFAFSDPVADG
ITIQASHLRALKHASMVKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
ADSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASNKDLEQAAMHSQGYIYTLARSGV
TGVSRILENDASAIIKTLKTFSPTPALLGFGISKKEHIKNAKGMGADGVICGSALVKIIE
ENLNDENAMLERIKGFIGEMIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagaaaaaatggcgtttatcccg
tttgtaaccttgggtgatcctaattatgaatggagttttgaaatcattaaaaccttaatt
gttagcggggtgagcgctttagaattggggtttgctttctccgatccggtagcggatggc
attaccatacaagcgagccatttaagagcgttaaaacacgctagcatggttaaaaatttc
cagctcttaagggcgatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gcagatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgctagccccaatgcgagtaataaagat
ttagaacaagccgctatgcattcgcaaggctatatctacactctggctaggagtggggtt
acaggagtgagccgtattttagaaaatgacgcgagtgctattattaaaaccttaaaaact
tttagccccacaccggccttactgggctttggcatttctaaaaaagaacacataaaaaac
gctaaaggcatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctggaaagaattaaagggtttataggagaaatg
atctcttaa

DBGET integrated database retrieval system