KEGG   Helicobacter pylori Cuz20: HPCU_06550Help
Entry
HPCU_06550        CDS       T01894                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
hpu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpu01100  Metabolic pathways
hpu01110  Biosynthesis of secondary metabolites
hpu01130  Biosynthesis of antibiotics
hpu01230  Biosynthesis of amino acids
Module
hpu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPCU_06550
Enzymes [BR:hpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPCU_06550
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPCU_06550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ADO04454
Position
complement(1331726..1333084)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSMLKKNHALPTNINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKIAKIYEKFASCISVLADSKYFLGSYENIKIVSQHSIKPILCKDFIVDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIKHLLKLQYDIIGI
NNRDLHTLTTDINHTLKLRPLLPKDALVVSESGIYSHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSQQEIAQLKKSLPKTCAIWQVGSVMN
ANDLAPKVKEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLETNPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtttctatgctcaaa
aaaaatcacgctttaccgacaaatataaacccaagcgatagggattttaaaaaggcgtta
ctagaaaaaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttgaaaatagccaaaatttatgaaaaattcgcctcttgc
atttcggttttagccgattctaaatattttttaggctcttatgaaaacattaagattgtt
tcgcaacattccattaagcccattttatgcaaagattttatcgttgatgcttttcaaatc
aaactcgctagaatgatgggggctaatgcggtgcttttaatgttaagcgtattagacgat
aaaaattatttagagcttttcaacctcgctaaatccttaaacatgagcgtgctgactgaa
gtttccaaccagcaagaaatcaagcacttgctcaaactccaatacgacattattggcatc
aataacagggatttacacaccctgacaaccgatattaaccacacgctcaaattacgcccc
cttttgcctaaagacgcgctcgtggtgagtgagtccggtatttattcgcatgcacaaatc
aaagccctagccccttatgtgaatggctttttagtgggtagctctttaatgaaagaaaag
gatttgaaaaaagcgtgtattaaattgattttaggcgagaataaagtgtgcgggcttaca
agaattaaagacgctaaagccgtttataaaaaccattttatttatggaggtttgattttt
gaaaaatcttcgcccagatacatcaagcctaaagaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataagattaaaaaaattcaaaaaatc
gctaaaaagcttgatttaaaagcggtgcagctttatggatattcgcaacaagaaatcgct
caattaaaaaaatcgcttcctaaaacttgcgcgatttggcaagtagggagcgtgatgaac
gctaacgatttagcgcctaaagttaaagaagcttctctaatcctatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggtattttagaaaatgtcaaaacg
cctttcatgttagctggcgggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattcaggtttagaaacaaaccctgggattaaaaataaggat
aaaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system