KEGG   Helicobacter pylori Cuz20: HPCU_07750Help
Entry
HPCU_07750        CDS       T01894                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpu  Helicobacter pylori Cuz20
Pathway
hpu00220  Arginine biosynthesis
hpu00330  Arginine and proline metabolism
hpu01100  Metabolic pathways
hpu01110  Biosynthesis of secondary metabolites
hpu01130  Biosynthesis of antibiotics
hpu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPCU_07750
   00330 Arginine and proline metabolism
    HPCU_07750
Enzymes [BR:hpu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPCU_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADO04688
Structure
PDB: 

Jmol
Position
complement(1567068..1568036)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIVQEQCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEVDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFNELKQLLGLLLESFKDRLKAVEVTEYNPTVSAKHTNEEERQVLE
ILDLIINSCKIKDKKPSFIMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttaagcgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcgttcaagagcagtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttgggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaagttgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttaccttagtctagatttagatattatggatggc
aagcttttcacttctactggcgtgcgtgaaaataacgggctgagttttaatgaattgaag
caattactgggcttgcttttagaaagctttaaagacagattaaaagccgttgaggtaacc
gaatataaccccacggtgagtgcaaaacacaccaacgaagaagaaaggcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagccatcttttataatg
agtcgctga

DBGET integrated database retrieval system