KEGG   Helicobacter pylori v225d: HPV225_0107Help
Entry
HPV225_0107       CDS       T01899                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpv  Helicobacter pylori v225d
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPV225_0107 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPV225_0107 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPV225_0107 (thrC)
Enzymes [BR:hpv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPV225_0107 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(92956..94416)
Genome map
AA seq 486 aa AA seqDB search
MPFAPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLKWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNDALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIEVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERALFDFFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
STTLLALNEQKKNDNDKTALETLKNSYNTPDSQRLDDLFEKGIKHQEILKLNEIKSSILL
WLESLH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgcccccacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcattttgaaacattaaaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcgcttg
ggattagagattcctaagggcttattaacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttaatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgatttcaacgacgctttaaaagcgcgccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgcgttaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcgaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgctctttaaagcaaacttactcaccggctatggatatttta
aaaagctctaatgtggaaagggcgctttttgatttctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaagttttatgcattaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagttgctcagatgaagcctgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaaccaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agcaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccagatagccaacgccttgatgatttatttgag
aaaggaatcaagcaccaagagattttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaagcctacattaa

DBGET integrated database retrieval system