KEGG   Helicobacter pylori v225d: HPV225_0122Help
Entry
HPV225_0122       CDS       T01899                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpv  Helicobacter pylori v225d
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPV225_0122
Enzymes [BR:hpv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPV225_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
110146..110784
Genome map
AA seq 212 aa AA seqDB search
MPSMNTHTRGIDSNLIHSLKSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKMDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPK
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKHFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNNDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcatgaacacacacacaagaggcattgacagcaatctgattcattcgctcaaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcgcgcattggcacgaatcaatttgtgatcaataaaaggaacgctgtttttgatcaattg
aatgaaaacaccttgctggttttgcatgataagatggattatcgctggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatagggagttcttggacgctaaattcatcgct
tatgcgcgccctccttatagcttggcgtattccttgcgccataaccgattgctccctaaa
gattatttagggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaa
cattttgtcttcattaaggggtgtgggatttttgcctaccacagggagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactgggcgatttaatg
gattattgctataataatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system