KEGG   Helicobacter pylori v225d: HPV225_0208Help
Entry
HPV225_0208       CDS       T01899                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpv  Helicobacter pylori v225d
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPV225_0208
   01230 Biosynthesis of amino acids
    HPV225_0208
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPV225_0208
   00051 Fructose and mannose metabolism
    HPV225_0208
   00562 Inositol phosphate metabolism
    HPV225_0208
Enzymes [BR:hpv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPV225_0208
Exosome [BR:hpv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPV225_0208
  Exosomal proteins of bladder cancer cells
   HPV225_0208
  Exosomal proteins of melanoma cells
   HPV225_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190041..190745
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLEELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGVQN
AYPKDCGAFTGEITLKHLEELKINTLLIGHSERRLLLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttagaagaattagaaaagactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagtgcaaaac
gcttaccctaaagattgtggggcttttaccggtgaaatcactttaaagcatttagaagaa
ctcaaaatcaacacgcttttaatagggcatagcgagaggcgattgcttttaaaggaaagc
cctagttttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgcattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
aacgagcaattagaaaatattgatcttaattatcccaatttagtggtggcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagatatttatctcacgcatggt
tttttaaagcaaattttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgcg
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgatcgggagcgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system