KEGG   Helicobacter pylori v225d: HPV225_0228Help
Entry
HPV225_0228       CDS       T01899                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hpv  Helicobacter pylori v225d
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpv01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hpv00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(207997..209163)
Genome map
AA seq 388 aa AA seqDB search
MDALEITQKLISYPTITPKECGIFEYIKSLFPTFKALECGENGVKNLFLYRIFTPPKKHA
EEKHAKKEHAKENVKPLHFCFAGHIDVVPPGNHWQSDPFKPIIKEGFLYGRGAQDMKGGV
GAFLSASLNFNPKTPFMLSVLLTSDEEGPGIFGTRLMLEKLKEKDLLPHMAIVAEPTCEK
VLGDSIKIGRRGSINGKLILKGTQGHVAYPQKCQNPIDALASVLPLISGVHLDDGDEYFD
PSKLVITNLHAGLGANNVTPASVEIIFNARHSLKTTKESLKEYLEKVLKNAPHALELESS
SSPFITDSHSKLASVLKENILKTCHNTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIH
AIDERVSLKELELLEKVFLGVLEDLSEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttagaaatcacccaaaagctcatcagctaccccaccatcacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctacttttaaagctctagagtgtgga
gaaaatggcgtgaaaaacctttttttataccgcatttttaccccccccaaaaagcatgca
gaagaaaagcatgcaaaaaaagagcatgcaaaagaaaatgttaagcccttgcatttttgc
tttgcagggcatattgatgtcgtgcctcctggaaatcattggcaaagcgatccctttaaa
cccattattaaagaggggtttttatacggccgtggggcgcaagacatgaaagggggcgtg
ggggcgtttttgagcgcgagtttaaattttaaccctaaaacccccttcatgctttctgtt
ttactcacaagcgatgaagaagggccaggaatttttggcactaggcttatgttagaaaaa
ctcaaagaaaaagatttgctccctcacatggcgattgtggctgaacccacttgcgaaaaa
gtcctaggcgatagcatcaaaatcggccgaagaggctctattaatggcaaactcatttta
aaaggcactcaagggcatgtagcttacccgcaaaaatgccaaaaccccattgatgcgctc
gcttctgttttgcccttgatttcaggagtccatttagacgatggcgatgaatattttgac
ccttcaaaattggttatcaccaacttgcatgcagggttaggagcgaataatgtaacgccc
gcaagcgtagaaattatctttaatgcgcgccattctttaaaaaccaccaaagagagtttg
aaagaatatttagaaaaggttttaaaaaacgcgcctcacgctttagaattagaatcaagc
agttcgcctttcatcacggattctcattcaaagcttgccagcgttttaaaagaaaatatt
ttaaagacatgccataacaccccccttttaaacaccaaaggcggcacgagcgatgcgcgg
ttttttagcgctcatggcatagaagtggtggaatttggcgttattaatgacagaatccat
gccattgatgaaagggtgagcttgaaagaattagagcttttagaaaaagtgtttttgggg
gttttagaggatttaagcgagaaatag

DBGET integrated database retrieval system