KEGG   Helicobacter pylori v225d: HPV225_0232Help
Entry
HPV225_0232       CDS       T01899                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hpv  Helicobacter pylori v225d
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hpv00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213760..214710
Genome map
AA seq 316 aa AA seqDB search
MAILDPNDLNGLEPLGAKVFVGLEGIDAMIEECVSNLVINAIVGVAGLRASFKSLQTNKK
LALANKESLVSAGHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLE
FIPIQNAQNALKHPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVH
ALVEFEDNSIIAHLASADMQLPISYAIDPKLASLSASIKPLDLYALSAIKFEPISMERYT
LWRYKDLLLENPKLGVVLNASNEVAMEKFLNQEIAFGGLIKTISQALESYAKTPFKLSDL
DEVLALDKEVRERFKN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtggcgattttagatcctaacgatttgaatggtttagagcctttgggtgcgaaagtgttt
gtagggctagagggcattgatgcgatgatagaagagtgcgtttcaaatttagtcattaat
gccattgtgggcgtagctggattgagggcgagttttaaaagcttgcaaactaacaaaaaa
ctagccctagcgaataaagaaagtttggtgagcgcggggcatttattagacatttcacaa
atcacgcccattgatagcgagcattttggtttgtgggcgttgttgcaaaacaaggcttta
aagcctaaatccttaatcattagcgcgagtgggggggctttcagggacacgcctttagaa
tttattcctattcaaaacgcgcaaaacgcgctcaagcaccctaattggagcatgggatct
aaaatcaccattgattcagcgagcatggtcaataagctttttgaaatcctagaaacctat
tggctttttggcgcgtctttaaagattgatgcgctgattgaaaggagttctatcgtgcat
gctttggtggagtttgaagataactctatcatcgcgcatttggcgagcgcggacatgcaa
ttacccataagctatgcgatcgatccgaagttggcctctttgagcgcgtctatcaagccc
ctagatttatacgctttaagcgcgattaaatttgaacccattagcatggagcgctacact
ttgtggcgttataaagacttgttgttggaaaacccaaagcttggcgtggtgctgaatgcg
agcaatgaggtggcgatggagaagtttttaaatcaagagatcgcttttggtgggcttatc
aaaaccatttctcaagccctagaatcatacgctaaaacgcctttcaagctctctgattta
gatgaagtgctagcactagataaggaagttagggaacggtttaaaaattag

DBGET integrated database retrieval system