KEGG   Helicobacter pylori v225d: HPV225_0294Help
Entry
HPV225_0294       CDS       T01899                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpv  Helicobacter pylori v225d
Pathway
hpv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpv01100  Metabolic pathways
hpv01110  Biosynthesis of secondary metabolites
hpv01130  Biosynthesis of antibiotics
hpv01230  Biosynthesis of amino acids
Module
hpv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpv00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPV225_0294
Enzymes [BR:hpv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPV225_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ADI34385
UniProt: D6XNP1
Position
270656..271213
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIISKTKDCVFVTPDEVLGKLLE
ENARTDCVIVNFKGLYEIGTPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKPDYTHLKDLGVLGVLEKVPHSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctaggtaaaagcctgtcgtataacccttacttgcctagaattatt
tctaaaaccaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacgcccgcaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcaca
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggcagaattt
gcttggcgtttgggcttaagtgtgtttgtagaaacccacaagccagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
atagtttttttagattga

DBGET integrated database retrieval system