KEGG   Helicobacter pylori v225d: HPV225_1257Help
Entry
HPV225_1257       CDS       T01899                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpv  Helicobacter pylori v225d
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPV225_1257
Enzymes [BR:hpv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HPV225_1257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1236773..1237453
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLK
ILQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEILPLLEKKSVLYLRAKEIAS
SLDTILLDHGIDFKQAVVYESKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEQGIQSYSAKKPSLEACLELALSLRGKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattttgctactatcccttagaattagatccgaccccttttaacgcccttattttc
acttctaaaaatgcggtgttttccctgctagaaactctaaaaaacagccccaaactcaaa
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaaccttacaagat
caccattttaaagtcgcctttataggggaaaaagcccatggcaaagagtttgttcaagaa
atccttcctttattggaaaaaaaaagcgttttgtatctcagggcaaaagagattgcctct
tctttagacaccattcttttagatcatggcattgatttcaagcaagccgttgtttatgaa
agcaagctcaaacatttgactttaagcgaacaaaacgccctaaaacccaaagaaaagagc
attcttatttttaccgccataagccatgcaaaagccttcttgcactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttgcaagagcaaggc
attcaaagctatagcgctaaaaagccctccttagaagcgtgtttagaactggctttgagt
ttgaggggtaaggaatgttaa

DBGET integrated database retrieval system