KEGG   Helicobacter pylori v225d: HPV225_1265Help
Entry
HPV225_1265       CDS       T01899                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpv  Helicobacter pylori v225d
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1242396..1243538
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDTLKNALLKTGSEKSAQTHMHKKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSASQLERLIAKCHSQPFGLKNLAQELKSHLKSQKPNNPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPQSEIIDPEIEQDR
LKEVLLEIKSQKLYQCAKFSIDTYHAKTAQMALEHYFSILNDVSGFNSVEMLEVAKDYKP
TCILMHTQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRV
HDIDEHIDLIKVFKSLEETN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaaccctgatacgctcaaaaatgcccttttaaaaaccggatca
gaaaaatccgctcaaacccatatgcataaaaaaggcgttagctttgtttttgaaatccaa
catctgcccttaagcgcaacgctgattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgctgatt
gtgagcgctagccagttagaacgccttattgccaagtgccattcccaaccctttgggctt
aaaaatttagcgcaagaattaaaaagccaccttaaatcccaaaagcctaacaacccacag
atcatggcaattttgaatctcacgccggatagcttctatgaaaagagccggtttgatagc
aaaaaagcgcttgaagaaatctatcaattattagaaaagggtatcacgctcattgatata
ggcgcagcgagttcaaggccacagagtgaaatcattgatccagaaatagagcaagatcgc
ttaaaagaagttttattagagatcaaatcccaaaaactctaccaatgcgctaaattcagc
atagacacctaccatgccaaaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttaatagcgttgaaatgctagaagtcgcaaaagattacaagccc
acttgcattttaatgcacactcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatctgtttgatgaaatggatcgcttttttaaggaaaaattagaggttttagaaaaa
tacgcgcttcaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcactgggcgtgaagttcaaaaccggctc
gccggcactttgagtttgcatctaatggcgttacaaaatggagcgagcattttaagagtg
catgacattgatgagcatatagacctcatcaaggtgtttaagagcttggaagaaacaaat
tga

DBGET integrated database retrieval system