KEGG   Helicobacter pylori v225d: HPV225_1309Help
Entry
HPV225_1309       CDS       T01899                                 

Definition
(GenBank) Phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpv  Helicobacter pylori v225d
Pathway
hpv00010  Glycolysis / Gluconeogenesis
hpv00030  Pentose phosphate pathway
hpv00051  Fructose and mannose metabolism
hpv00052  Galactose metabolism
hpv00230  Purine metabolism
hpv00500  Starch and sucrose metabolism
hpv00520  Amino sugar and nucleotide sugar metabolism
hpv00521  Streptomycin biosynthesis
hpv01100  Metabolic pathways
hpv01110  Biosynthesis of secondary metabolites
hpv01120  Microbial metabolism in diverse environments
hpv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPV225_1309
   00030 Pentose phosphate pathway
    HPV225_1309
   00051 Fructose and mannose metabolism
    HPV225_1309
   00052 Galactose metabolism
    HPV225_1309
   00500 Starch and sucrose metabolism
    HPV225_1309
   00520 Amino sugar and nucleotide sugar metabolism
    HPV225_1309
  Nucleotide metabolism
   00230 Purine metabolism
    HPV225_1309
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPV225_1309
Enzymes [BR:hpv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPV225_1309
    5.4.2.8  phosphomannomutase
     HPV225_1309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADI35342
UniProt: D6XRE8
Position
1286667..1288043
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMREYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNVQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPKKANALEAYQRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFNSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINAFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPKIKEMISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKKALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagat
gaaaagagcgcttttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgctagggtgcatgggcgatcgctttttgaagctttgagc
gcggggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagacaatgtccaatgccccaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaagacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttaatagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatgtttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatgcttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaagcgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaatgatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccgtatttagtcagccgctttgaaggcaaa
gatgaaacaacggcgttagaatataaaaaagcgctactcaatttgctagagaaataa

DBGET integrated database retrieval system