KEGG   Helicobacter pylori v225d: HPV225_1311Help
Entry
HPV225_1311       CDS       T01899                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpv  Helicobacter pylori v225d
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPV225_1311 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPV225_1311 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPV225_1311 (trpA)
Enzymes [BR:hpv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPV225_1311 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1288687..1289475)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLITSGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLKKIRGYNHDIPIGLLAYANLIFSYGVDNFYAQIKECG
ADSVLIADMPLIEKELVLKSAQKYQIKQIFIASPNASNKDLEQAAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKTFSSTPALLGFGISKKEHIKNAKGMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaatggagttttgaaatcattaaaactttaatt
actagcggggtgagcgctttagaattggggtttgctttctcagacccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacatgctagcatggctaaaaatttc
cagcttttaaaaaagattagaggctacaaccatgatattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gcagatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaataccagattaaacaaatctttatcgccagccccaatgcgagtaataaagat
ttagaacaagccgctatgcattcgcaaggctatatctacactctggctaggagtggggtt
acaggagcgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaact
tttagttctaccccggccttattaggctttggcatttctaaaaaagaacacataaaaaac
gctaaaggcatgggcgctgatggcgtgatctgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctggaaaaaattaaagggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system