KEGG   Helicobacter pylori v225d: HPV225_1461Help
Entry
HPV225_1461       CDS       T01899                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpv  Helicobacter pylori v225d
Pathway
hpv00220  Arginine biosynthesis
hpv00330  Arginine and proline metabolism
hpv01100  Metabolic pathways
hpv01110  Biosynthesis of secondary metabolites
hpv01130  Biosynthesis of antibiotics
hpv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpv00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPV225_1461 (rocF)
   00330 Arginine and proline metabolism
    HPV225_1461 (rocF)
Enzymes [BR:hpv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPV225_1461 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADI35484
UniProt: D6XRU0
Structure
PDB: 

Jmol
Position
complement(1417107..1418075)
Genome map
AA seq 322 aa AA seqDB search
MILVALEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIVQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKYLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFNELKQLLGLLLESFKDRLRAVEVTEYNPTVSAKHTDEEEKQVLE
ILDLIINSCKIKDKKPSFIMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtagcattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttaagcgcaacgcatggcgatgtgattaaaggcatgcaa
acgattgttcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgttctttggggttagaaaagggagcgttagaaattgatcctaaatatttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttatctcagtttggatttagacattatggatggc
aagcttttcacttctactggcgtgcgtgaaaataacgggctgagttttaatgaattaaag
caattactgggcttgcttttagaaagctttaaagacagattaagagccgttgaggtaacc
gaatacaaccccacggtgagtgcaaaacacaccgacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagccatcttttataatg
agtcgctga

DBGET integrated database retrieval system