KEGG   Helicobacter pylori 2018: hp2018_01221Help
Entry
hp2018_01221      CDS       T01914                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpw  Helicobacter pylori 2018
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpw00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
116892..117440
Genome map
AA seq 182 aa AA seqDB search
MNTHTRGIDSGLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNEN
TLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYL
GYRSLGEEIAIFNPKDYDSWQERADTEILRQLQESKKYFVFIRGAGFLPTIGSFLNSWKF
LI
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacacaagaggtattgatagcgggctgatccattcgctccaaagcatttca
ttatccatgtttagaaagggtttttttgggctttatcaaggctccatttcggcgcgcatt
ggcactaatcagtttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaac
accttactggtcttgcatgacaagatagattaccgctggaaagaagcgagcctggattcg
cccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgcttacgcacgc
cctccttatagcctagcgtattctttgcgtcataaccgattgctccctagggattattta
gggtatcgttctttgggcgaagaaatcgccatttttaaccccaaagactatgacagctgg
caagaaagagcggatacagaaattttacgccaattgcaagagagtaagaaatattttgtt
ttcataaggggtgcgggatttttgcctaccatagggagctttctaaactcatggaagttt
ttgatttga

DBGET integrated database retrieval system