KEGG   Helicobacter pylori 2018: hp2018_01221Help
Entry
hp2018_01221      CDS       T01914                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpw  Helicobacter pylori 2018
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpw00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    hp2018_01221
Enzymes [BR:hpw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     hp2018_01221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
116892..117440
Genome map
AA seq 182 aa AA seqDB search
MNTHTRGIDSGLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNEN
TLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYL
GYRSLGEEIAIFNPKDYDSWQERADTEILRQLQESKKYFVFIRGAGFLPTIGSFLNSWKF
LI
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacacaagaggtattgatagcgggctgatccattcgctccaaagcatttca
ttatccatgtttagaaagggtttttttgggctttatcaaggctccatttcggcgcgcatt
ggcactaatcagtttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaac
accttactggtcttgcatgacaagatagattaccgctggaaagaagcgagcctggattcg
cccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgcttacgcacgc
cctccttatagcctagcgtattctttgcgtcataaccgattgctccctagggattattta
gggtatcgttctttgggcgaagaaatcgccatttttaaccccaaagactatgacagctgg
caagaaagagcggatacagaaattttacgccaattgcaagagagtaagaaatattttgtt
ttcataaggggtgcgggatttttgcctaccatagggagctttctaaactcatggaagttt
ttgatttga

DBGET integrated database retrieval system