KEGG   Helicobacter pylori 2018: hp2018_0241Help
Entry
hp2018_0241       CDS       T01914                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpw  Helicobacter pylori 2018
Brite
Enzymes [BR:hpw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     hp2018_0241
Secretion system [BR:hpw02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   hp2018_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
233498..234295
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLIKVIEKQTNKKVRILETKPLKSNQD
LKIVVVEDPDTKYQIPLVVSKDGNLVIGLSGIFFSNNSEDVKLLTETNQKIQALNATQQN
SAKLNALFDEVPADYVIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagtgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggacaatttgattaaagtgattgaa
aaacaaaccaataaaaaggtgcgtattttagagactaaacccttgaaatccaatcaagat
ttaaaaatcgtggtggtagaagatccggacactaaataccaaatcccgcttgtagtgagt
aaggatggtaatttagtcatagggcttagcggtatcttttttagcaataatagcgaagac
gtgaagttgctcacagagaccaatcaaaaaattcaagcccttaacgctacgcaacaaaat
agcgcgaagttgaacgctctttttgatgaagtgccggctgattatgtgatagagttgccc
tctactaacgctgaaaataaggataaaatcctttatattgtctctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggtcaattcggctaaaaaggcggctttgatccaagaagaa
atggcgaaggctagggctaggggagcgagcgtggaagataagatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggcgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system