KEGG   Helicobacter pylori 2018: hp2018_0369Help
Entry
hp2018_0369       CDS       T01914                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hpw  Helicobacter pylori 2018
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hpw00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hpw00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
366335..367258
Genome map
AA seq 307 aa AA seqDB search
MPKKCRHLLQTSDLSLDEIKLLLNKASVYANDFNAVSLETREKMQDKIIVALFFENSTRT
VSSFEIASLRLGAKIVKLNMQTSSTSKGETLIDTFKNIHAMQPDAIITRHAFSSAPFKLA
EFSQCPLINAGSGTSAHPTQALLDLLTLYRHFGSLENLKGKKIAFIGDVKNSRVANSNIK
LLQRLGLEIMLCAPSSMLPITPLKTTHNVEEAIGFADILMSLRTQTERHNVPIFASLKDY
GNAYCITQKRLDDHAKNKEVIILHPGPVHRDIDIESTVLEDKRSKVLEQVKNGVAMRMAV
LEFLLIN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaaatgccgacacttgctccaaaccagcgatttaagcttggatgaaatcaag
cttttattgaacaaagcgagcgtttatgcgaacgattttaacgccgtgtctttagagaca
agagaaaaaatgcaagataaaatcatcgtggcgttattttttgaaaattccaccagaacg
gtgtctagctttgaaatcgcaagcttgaggttaggggcaaaaatagtgaaattaaacatg
caaacgagctccacttcaaagggtgaaactctgatagacacttttaaaaatatccatgcc
atgcagcctgacgctatcatcacacggcatgctttttcaagcgcgccttttaaattggct
gaattttcacaatgccccttgattaacgcaggaagcggcacaagcgctcaccctacccaa
gcgttattagacttgctcaccctttatcggcattttggcagtttggaaaatctaaaaggg
aagaaaatcgcttttataggcgatgtgaaaaattcaagagtggctaatagcaacattaaa
ttactccaaaggctagggcttgagatcatgctgtgcgctccaagctccatgctccctatc
actcctttaaaaacgacgcataacgttgaagaagcgataggatttgctgacattttaatg
agcttgaggacccaaaccgaacggcacaacgtgcccatttttgcgagcttgaaagattac
ggcaacgcttattgcatcacccaaaaacgcctagatgatcacgctaaaaataaagaggtc
attattttacacccaggcccggtgcatagggatattgatatagaaagcacggtgttagaa
gacaagcgatctaaagttttagagcaagtcaaaaatggcgtggcaatgcgcatggcggtg
ttggaatttttgctaataaattaa

DBGET integrated database retrieval system