KEGG   Helicobacter pylori 2018: hp2018_0913Help
Entry
hp2018_0913       CDS       T01914                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I (EC:3.5.4.16)
  KO
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hpw  Helicobacter pylori 2018
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    hp2018_0913 (folE)
Enzymes [BR:hpw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     hp2018_0913 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
931552..932094
Genome map
AA seq 180 aa AA seqDB search
MENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGVCDEMI
VAQNIEFYSTCEHHLLPFLGNISVGYIPKEKIVGISAIAKLIEIYSKRLQIQERLTTQIA
ETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDPKTRAEFMQLLKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttttcaaccaattttttgaaaatatcggcgaagataagaatagggagggt
ttgaaagagacgcctaaaagggttcaagaattatggaaattcttgtataaaggctataaa
gaagatcctagagtggctttaaaaagcgcgtattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacattgaattttactccacttgcgagcaccatttgctcccttttttgggg
aatattagcgtgggatatatccctaaggaaaagattgtaggcattagcgcgatcgctaaa
ctcattgaaatttatagcaaacgcttgcaaatccaagaaaggctgaccactcaaattgca
gaaacttttgatgaaatcatagagccaaggggcgtgatcgtggtttgtgaagccaaacat
ttgtgcatgagcatgcaaggggtgcaaaagcaaaatgcgatcattaaaacaagtgtgtta
agaggcctcttcaaaaaagaccctaaaaccagagctgaatttatgcaactcttaaaatct
tag

DBGET integrated database retrieval system