KEGG   Helicobacter pylori 2018: hp2018_1047Help
Entry
hp2018_1047       CDS       T01914                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hpw  Helicobacter pylori 2018
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1069752..1070381
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEIHKRFNLHPKVRKAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLDNVHVKFADGNKGWERYAPYDRILFSACAKNIPQALVDQLEEGGILVAPIQENNEQVI
KRFVKQNNALHVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtatcaaaaaccatttgatgtgtgaagaaatccataagcgtttcaatttacac
cccaaagtgagaaaagctatggagagcattgaaagggaggtttttgtgccagcccccttc
aaacattttgcctacaccttaaacgcgctttctatgcaagcgcaacaatacatttcttcg
cccttaaccgtggccaaaatgacgcaatatttagaaatcgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggttttgtctcaaattttcaggcgtgtt
ttcagcattgaaaggattgaaagcctgtatatagaagcgcgtttgcgccttaaaactctc
ggtttagacaacgttcatgtcaaattcgctgatgggaataagggctgggagcgatacgcc
ccctatgataggattttgttctctgcttgcgctaaaaatatcccccaagcgcttgtcgat
cagcttgaagaaggcgggatattagttgcgcccattcaagaaaacaacgagcaagtgatc
aaacgctttgtgaaacaaaataacgccttgcacgtccaaaaagtgctagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system