KEGG   Helicobacter pylori 2018: hp2018_1058Help
Entry
hp2018_1058       CDS       T01914                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hpw  Helicobacter pylori 2018
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    hp2018_1058
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp2018_1058
   00052 Galactose metabolism
    hp2018_1058
   00500 Starch and sucrose metabolism
    hp2018_1058
   00520 Amino sugar and nucleotide sugar metabolism
    hp2018_1058
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    hp2018_1058
   00524 Butirosin and neomycin biosynthesis
    hp2018_1058
Enzymes [BR:hpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     hp2018_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081865..1082875
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECVEVLRCEDFESLSDAVRFYLSKCKESLK
LRPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVMKKTPGLDGAGIALENYLLHDRI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacaaacgcgcgc
tttggtttggaagtcgccccacgacagattgaatgtgttgaagtcttgaggtgcgaagat
tttgaaagcttgagcgatgcggtgcggttttacctttctaaatgcaaagaaagccttaaa
ctgcgccctatttatggctcttttgctgtggctacgcccatcatgggggattttgtccaa
atgacgaacaaccactggactttttctattgagacgacacggcaatgtttgaatttaaaa
aaactgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgagatcaacgcccctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttacccggtgaaggggggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggg
agcggcttggtgctgatttatgaagctttatccaaacgaaaaggcttagaaaaagtggcg
aaattgagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgcttggcacgctcgctgct
gatgtggccctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggggcgtttctcgcttccatccctgtgcatgtcgtgatgaaaaaaactcccggactt
gatggggcgggcattgcgttagaaaattatttactgcatgatagaatttag

DBGET integrated database retrieval system