KEGG   Helicobacter pylori 2018: hp2018_1064Help
Entry
hp2018_1064       CDS       T01914                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hpw  Helicobacter pylori 2018
Pathway
hpw00010  Glycolysis / Gluconeogenesis
hpw00020  Citrate cycle (TCA cycle)
hpw00620  Pyruvate metabolism
hpw00640  Propanoate metabolism
hpw00650  Butanoate metabolism
hpw00680  Methane metabolism
hpw01100  Metabolic pathways
hpw01120  Microbial metabolism in diverse environments
hpw01130  Biosynthesis of antibiotics
hpw01200  Carbon metabolism
Module
hpw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp2018_1064
   00020 Citrate cycle (TCA cycle)
    hp2018_1064
   00620 Pyruvate metabolism
    hp2018_1064
   00640 Propanoate metabolism
    hp2018_1064
   00650 Butanoate metabolism
    hp2018_1064
  Energy metabolism
   00680 Methane metabolism
    hp2018_1064
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    hp2018_1064
Enzymes [BR:hpw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     hp2018_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ADZ51779
Position
1088493..1089053
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDNEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaataagatggcatgcgcgagctggtcaaggcgctatcaccggcgctaaaggg
ctagctgatgtgatttcaaagacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcattgataatgagcctattttaaac
catgagcgtttcatgcaaccggattatgtgctggtgattgaccctggtttggttttcatt
gaaaacattttcgctaatgaaaaagaagacacgacctatatcatcactagctaccttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttggtggat
tgtttaaaaatctctatggaaaccttaaaacgccctatccctaacacgcccatgttaggg
gcgttgatgaaagtgtctggcatgcttgaaatcggggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system