KEGG   Helicobacter pylori 2018: hp2018_1067Help
Entry
hp2018_1067       CDS       T01914                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpw  Helicobacter pylori 2018
Pathway
hpw00010  Glycolysis / Gluconeogenesis
hpw00020  Citrate cycle (TCA cycle)
hpw00620  Pyruvate metabolism
hpw00640  Propanoate metabolism
hpw00650  Butanoate metabolism
hpw00680  Methane metabolism
hpw01100  Metabolic pathways
hpw01120  Microbial metabolism in diverse environments
hpw01130  Biosynthesis of antibiotics
hpw01200  Carbon metabolism
Module
hpw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp2018_1067
   00020 Citrate cycle (TCA cycle)
    hp2018_1067
   00620 Pyruvate metabolism
    hp2018_1067
   00640 Propanoate metabolism
    hp2018_1067
   00650 Butanoate metabolism
    hp2018_1067
  Energy metabolism
   00680 Methane metabolism
    hp2018_1067
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    hp2018_1067
Enzymes [BR:hpw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     hp2018_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: ADZ51782
Position
1090707..1091651
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQRPKFVAFGGDGASYDIGFQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKYIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFDSNKTIELADM
AVDSLMFPLFEVFNGRELKITYRPRNIIPVRDYLAAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgagaaatttcaaggc
tcgcacttgctttgtcccggttgtgggcatggcatcattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggctgtg
tacccgcacacttcatgggatgtgccttggattcatatcggttttgaaaatggctctacc
gctatttcaggggtagaagcgatgtataaggctttagtgaataagggccgctatcaaggt
caaagaccgaaattcgtggcgtttggaggcgatggggctagttatgatattggttttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcttggataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccagcgggatcggttagctttggcaaaaaagaaaagaaaaaatacatcgtcaat
atcatggcaagccatggggtcccttatgtggcgcaactctcgcctaacaaatggaaagac
atgaataaaaagattaagaccgcgctagacactgaagggccttgcttcatcaacgctctt
agcccatgcacgactgaatggaaatttgattccaataagaccattgaattagcggatatg
gctgtggatagcttgatgttccccttgtttgaagtctttaatggtagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttagcggctcaaaagcgtttc
aaacaccttttcaaaaaggaaaacgaacacatcattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system