KEGG   Helicobacter pylori 2018: hp2018_1183Help
Entry
hp2018_1183       CDS       T01914                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpw  Helicobacter pylori 2018
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hpw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1212642..1213304
Genome map
AA seq 220 aa AA seqDB search
MHSQRIAPYKTLILNELCYYPLELDLTPFNALIFTSKNAVFSLLKTLKNSPKLKILQNIP
AYALSEPTAKTLQDHHFKTAFIGEKAHGKEFAQEILPLLEKKSVLYLRAKEIASSLDAIL
LEHGINFQQAVVYENKLKHLTLSEQNALKPQEKSVLIFTAISHAKAFLHYFEFLKSYTAI
SIGNTTALYLQEQGIQSYIAQKPSLEACLELALNLRVKEC
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgcattctcaaagaatcgccccttataaaactctcattttaaatgaattatgctactat
cctttagaattggatttaaccccttttaacgccctgattttcacttctaaaaatgcggtg
ttttccttgctaaaaaccctaaaaaacagccccaaactcaaaattttacaaaacattcct
gcttacgctttgagcgaacccaccgcaaaaactctacaagatcaccattttaaaaccgcc
tttataggggaaaaagcccatggcaaagagtttgctcaagaaatccttcctttattggaa
aaaaaaagcgttttgtatctcagggcaaaagaaattgcctcttctttagacgctattctt
ttagagcatggcatcaatttccaacaagccgttgtttatgaaaacaagctcaaacatttg
actttaagcgagcaaaacgccctaaaaccccaagaaaagagcgttcttattttcaccgcc
ataagccatgcgaaagcctttttacactattttgaatttttaaaaagttacaccgccata
agcattggcaacacgaccgctctttatttacaagaacaaggcattcaaagctatatagct
caaaagccctccttagaagcatgtttagaactggctttaaatttgagagttaaggaatgt
taa

DBGET integrated database retrieval system